PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C02096.1.p
Common NameEUGRSUZ_C02096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 379aa    MW: 42350.2 Da    PI: 4.9354
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C02096.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-1785132148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+ Ed++l d+vk++G g W++ +r+ g++R++k+c++rw +yl
  Eucgr.C02096.1.p  85 KGAWTAAEDQILMDYVKLHGEGKWSRLSRETGLRRCGKSCRLRWMNYL 132
                       79********************************************97 PP

2Myb_DNA-binding52.89.1e-17138182147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ +++E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
  Eucgr.C02096.1.p 138 RGNISPDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 182
                       7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.99380136IPR017930Myb domain
SuperFamilySSF466892.37E-2983179IPR009057Homeodomain-like
SMARTSM007179.0E-1484134IPR001005SANT/Myb domain
PfamPF002495.7E-1585132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2386139IPR009057Homeodomain-like
CDDcd001674.07E-1187132No hitNo description
SMARTSM007173.6E-16137185IPR001005SANT/Myb domain
PROSITE profilePS5129419.613137187IPR017930Myb domain
PfamPF002495.5E-15138183IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-24140186IPR009057Homeodomain-like
CDDcd001671.27E-12142183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MSGPLRAPAR PEPPETIPDP VQHQLPRAIV TPDPSTPPLL SSLTLPLISS LLSSGYMQEF  60
EGERGRERAL NMGRSPRCDK DGLNKGAWTA AEDQILMDYV KLHGEGKWSR LSRETGLRRC  120
GKSCRLRWMN YLRPDIKRGN ISPDEEELII RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN  180
TNLAKKPEAL RSIQFHHLHR EPMVEPPGTS QQELEQQRVP ESNIRGVANP EPQVAQQNAA  240
NGEMRSSPDG NYLLKQMLSD SDMSDGSLSF NSEEESPDFM IDFNVDDISQ FLDSDFYKLG  300
PDQNGYSHDG ERGSKCPPYL NQQLVPPEEA GKDLDNSLRI RDDSVSAFQS LASLFESDDE  360
KWTGGGDKAD FALPGKNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26831865107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C02096.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048454.10.0PREDICTED: transcription factor MYB90-like
TrEMBLA0A059CR510.0A0A059CR51_EUCGR; Uncharacterized protein
STRINGGLYMA13G16890.13e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.12e-60myb domain protein 3